PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast07G127300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 331aa    MW: 35782.2 Da    PI: 8.1813
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast07G127300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.66.7e-55131411128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+++yL +kv++ +++ +++i+e+d++k+ePw+Lp k+k +ekewyf+s rd+ky+tg r+nrat +gyWkatgkd+e
  Brast07G127300.2.p  13 LPPGFRFHPTDEELISYYLLRKVADVSFSGARAIAEIDLNKCEPWELPDKAKMGEKEWYFYSLRDRKYPTGLRTNRATGAGYWKATGKDRE 103
                         79****************************999***************99999************************************** PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         + s+ +g+lvg+kktLvfy+grapkg+kt+Wvmhe+rl
  Brast07G127300.2.p 104 IRSArTGALVGMKKTLVFYRGRAPKGSKTQWVMHEFRL 141
                         **9868889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-6012167IPR003441NAC domain
PROSITE profilePS5100559.00913167IPR003441NAC domain
PfamPF023652.5E-2714141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0010160Biological Processformation of organ boundary
GO:0010223Biological Processsecondary shoot formation
GO:0048366Biological Processleaf development
GO:0048504Biological Processregulation of timing of organ formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MERYGMRDQD GELPPGFRFH PTDEELISYY LLRKVADVSF SGARAIAEID LNKCEPWELP  60
DKAKMGEKEW YFYSLRDRKY PTGLRTNRAT GAGYWKATGK DREIRSARTG ALVGMKKTLV  120
FYRGRAPKGS KTQWVMHEFR LDGNYAYHFF SNNAARDEWV IAKIFVKPGA PPAARNKLAR  180
FGLGSTGADT SSCFSDSTTS VSVGCGGADT TTTSMFAAAA DGESSSYGNN CGRELVPCFS  240
TGAHMDATLL GIGQYDPAPL AMEQPLAAAL YQSAAARSVQ DNLLFLSGAG LQSGGGAFQY  300
WPSASGHDMK PPAQMAVGPG QLDGSFAWGF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-521316717165NAC domain-containing protein 19
4dul_A2e-521316717165NAC domain-containing protein 19
1ut7_B2e-521316717165NO APICAL MERISTEM PROTEIN
1ut7_A2e-521316717165NO APICAL MERISTEM PROTEIN
1ut4_B2e-521316717165NO APICAL MERISTEM PROTEIN
1ut4_A2e-521316717165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00562DAPTransfer from AT5G53950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0046791e-162AP004679.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBa0021N09.
GenBankAP0149621e-162AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankCP0126141e-162CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563845.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
SwissprotO040171e-85NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLA0A0Q3H6Y00.0A0A0Q3H6Y0_BRADI; Uncharacterized protein
STRINGMLOC_65286.11e-146(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.11e-85NAC family protein